ZBTB7A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130905
| Artikelname: |
ZBTB7A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130905 |
| Hersteller Artikelnummer: |
orb2130905 |
| Alternativnummer: |
BYT-ORB2130905-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ZBTB7A |
| Konjugation: |
Biotin |
| Alternative Synonym: |
L, Lrf, Pok, FBI-, FBI-1, Zbtb7, Pokemon, AI452336, 9030619K07Rik, 9130006G12Rik |
| ZBTB7A Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
60kDa |
| NCBI: |
034861 |
| UniProt: |
O88939 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEF |
