LHX8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130914
Artikelname: LHX8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130914
Hersteller Artikelnummer: orb2130914
Alternativnummer: BYT-ORB2130914-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse LHX8
Konjugation: Biotin
Alternative Synonym: LHX7
LHX8 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 001001933
UniProt: Q68G74
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VSPNHSSSAPVTAVPSSRLSPPMLEEMAYSAYVPQDGTMLTALHSYMDAH