Irx2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130926
Artikelname: Irx2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130926
Hersteller Artikelnummer: orb2130926
Alternativnummer: BYT-ORB2130926-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Irx2
Konjugation: Biotin
Alternative Synonym: IR
Irx2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 034704
UniProt: P81066
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RRLKKENKMTWAPRNKSEDEDEDEGDASRSKEESSDKAQDGTETSAEDEG