HOXB7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130935
Artikelname: HOXB7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130935
Hersteller Artikelnummer: orb2130935
Alternativnummer: BYT-ORB2130935-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse HOXB7
Konjugation: Biotin
Alternative Synonym: Hox-2., Hox-2.3, AI325018
HOXB7 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 034590
UniProt: P09024
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFH