Hoxa1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130947
| Artikelname: |
Hoxa1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130947 |
| Hersteller Artikelnummer: |
orb2130947 |
| Alternativnummer: |
BYT-ORB2130947-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the c terminal region of mouse Hoxa1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
ER, ERA1, Hox-1., Hox-1.6 |
| Hoxa1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
36 |
| NCBI: |
034579 |
| UniProt: |
B9EHK7 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: ETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPS |
