HMG20B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2130959
| Artikelname: |
HMG20B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2130959 |
| Hersteller Artikelnummer: |
orb2130959 |
| Alternativnummer: |
BYT-ORB2130959-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Biotin |
| Alternative Synonym: |
BRAF, Smar, Hmgx2, BRAF35, Hmgxb2, AW610687, Smarce1r |
| HMG20B Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
35kDa |
| NCBI: |
034570 |
| UniProt: |
Q9Z104 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MSHGPRQPGAATAPAGGKTPGQHGAFVVAVKQERSEGSRAGEKGPQEEEP |
