Fkhl18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2130971
Artikelname: Fkhl18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2130971
Hersteller Artikelnummer: orb2130971
Alternativnummer: BYT-ORB2130971-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the c terminal region of mouse Fkhl18
Konjugation: Biotin
Alternative Synonym: Fkh3, FREAC, Fkhl1, Fkhl18, FREAC10
Fkhl18 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35
NCBI: 034356
UniProt: Q61574
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MQTLNFCMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVA