Tfam Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2131055
| Artikelname: |
Tfam Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2131055 |
| Hersteller Artikelnummer: |
orb2131055 |
| Alternativnummer: |
BYT-ORB2131055-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Tfam |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Hmgt, mtTF, tsHM, Hmgts, mtTFA, tsHMG, AI661103 |
| Tfam Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
27kDa |
| NCBI: |
033386 |
| UniProt: |
P40630 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: FQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWE |
