Sin3b Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131079
Artikelname: Sin3b Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131079
Hersteller Artikelnummer: orb2131079
Alternativnummer: BYT-ORB2131079-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse Sin3b
Konjugation: Biotin
Alternative Synonym: 2810430C10Rik
Sin3b Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 105kDa
NCBI: 033214
UniProt: A1L326
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPV