Neo1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2131136
| Artikelname: |
Neo1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2131136 |
| Hersteller Artikelnummer: |
orb2131136 |
| Alternativnummer: |
BYT-ORB2131136-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Neo1 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Igdcc, Igdcc2, AI327052, 2610028H22Rik, D930014N22Rik |
| Neo1 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
163kDa |
| NCBI: |
032710 |
| UniProt: |
E9QK04 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: PPPPLLLLLPLLLLLGRPASGAAATKSGSPPQSAGASVRTFTPFYFLVEP |
