Arntl Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2131310
| Artikelname: |
Arntl Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2131310 |
| Hersteller Artikelnummer: |
orb2131310 |
| Alternativnummer: |
BYT-ORB2131310-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Arntl |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Ar, MO, Bma, MOP3, Arnt3, Bmal1, bHLHe, BMAL1b, bHLHe5, bmal1b |
| Arntl Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
69kDa |
| NCBI: |
031515 |
| UniProt: |
Q3UHZ2 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: GQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMS |
