Noto Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131328
Artikelname: Noto Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131328
Hersteller Artikelnummer: orb2131328
Alternativnummer: BYT-ORB2131328-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of mouse Noto
Konjugation: Biotin
Alternative Synonym: N, Fl, tc, Flh, MmN, Not, MmNot
Noto Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 001007473
UniProt: A8MTQ0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VQPGSLRPCPGAVSPVVPRRLARGRLESSFSVEAILARPKTRELAATSLP