Rhox8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131334
Artikelname: Rhox8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131334
Hersteller Artikelnummer: orb2131334
Alternativnummer: BYT-ORB2131334-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rhox8
Konjugation: Biotin
Alternative Synonym: To, Tox
Rhox8 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 001004193
UniProt: Q6VSS7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RISRSRSTVNSIHAMEPQEVTQSSLLRDDEIKESDDAAAWIVSQEMKERE