MCM8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131508
Artikelname: MCM8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131508
Hersteller Artikelnummer: orb2131508
Alternativnummer: BYT-ORB2131508-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MCM8
Konjugation: Biotin
Alternative Synonym: POF10, C20orf154, dJ967N21.5
MCM8 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 94kDa
NCBI: 115874
UniProt: Q9UJA3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ELRDAPEKTLACMGLAIHQVLTKDLERHAAELQAQEGLSNDGETMVNVPH