DHX57 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131721
Artikelname: DHX57 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131721
Hersteller Artikelnummer: orb2131721
Alternativnummer: BYT-ORB2131721-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DHX57
Konjugation: Biotin
Alternative Synonym: DDX57
DHX57 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 155kDa
NCBI: 945314
UniProt: Q6P158
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LSGRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATG