SHPRH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131730
Artikelname: SHPRH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131730
Hersteller Artikelnummer: orb2131730
Alternativnummer: BYT-ORB2131730-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SHPRH
Konjugation: Biotin
Alternative Synonym: bA545I5.2
SHPRH Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 190kDa
NCBI: 775105
UniProt: Q149N8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL