TDRD9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131739
Artikelname: TDRD9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131739
Hersteller Artikelnummer: orb2131739
Alternativnummer: BYT-ORB2131739-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TDRD9
Konjugation: Biotin
Alternative Synonym: HLS, SPNE, HIG-1, NET54, SPGF30, C14orf75
TDRD9 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 103kDa
NCBI: 694591
UniProt: Q8NDG6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM