TMEM108 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2131775
Artikelname: TMEM108 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2131775
Hersteller Artikelnummer: orb2131775
Alternativnummer: BYT-ORB2131775-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM108
Konjugation: Biotin
Alternative Synonym: RTLN, CT124
TMEM108 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
UniProt: Q6UXF1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI