ZNF397 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132471
Artikelname: ZNF397 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132471
Hersteller Artikelnummer: orb2132471
Alternativnummer: BYT-ORB2132471-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF397
Konjugation: Biotin
Alternative Synonym: ZNF47, ZSCAN15
ZNF397 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 61kDa
NCBI: 001128650
UniProt: Q8NF99
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: VQQHNPESGEEAVTLLEDLEREFDDPGQQVPASPQGPAVPWKDLTCLRAS