HOXA3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132486
Artikelname: HOXA3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132486
Hersteller Artikelnummer: orb2132486
Alternativnummer: BYT-ORB2132486-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HOXA3
Konjugation: Biotin
Alternative Synonym: HOX1, HOX1E
HOXA3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 109377
UniProt: O43365
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPAC