ZNF665 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132519
Artikelname: ZNF665 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132519
Hersteller Artikelnummer: orb2132519
Alternativnummer: BYT-ORB2132519-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF665
Konjugation: Biotin
Alternative Synonym: ZFP160L
ZNF665 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 78kDa
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LGVSFQSHLPELQQFQREGKIYEYNQVEKSPNNRGKHYKCDECGKVFSQN