Wiz Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132591
Artikelname: Wiz Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132591
Hersteller Artikelnummer: orb2132591
Alternativnummer: BYT-ORB2132591-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Wiz
Konjugation: Biotin
Wiz Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 105kDa
NCBI: 997603
UniProt: O88286
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TSPPGTVKSEEHQRQNINKFERRQARPSDASAARGGEEVNDLQQKLEEVR