SBZF3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132645
Artikelname: SBZF3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132645
Hersteller Artikelnummer: orb2132645
Alternativnummer: BYT-ORB2132645-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SBZF3
Konjugation: Biotin
Alternative Synonym: SBZF3
SBZF3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 54kDa
UniProt: Q9HD74
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: FNMQFLFHSLAMSKPELIICLEARKEPWNVNTEKTAKHSALSSYLTEDIL