ZNF358 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132687
Artikelname: ZNF358 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132687
Hersteller Artikelnummer: orb2132687
Alternativnummer: BYT-ORB2132687-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF358
Konjugation: Biotin
Alternative Synonym: ZFEND
ZNF358 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 060553
UniProt: Q9NW07
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LILDPNSDTLSPGDPKVDPISSGLTATPQVLATSPAVLPAPASPPRPFSC