L3MBTL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2132771
| Artikelname: |
L3MBTL Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2132771 |
| Hersteller Artikelnummer: |
orb2132771 |
| Alternativnummer: |
BYT-ORB2132771-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human L3MBTL |
| Konjugation: |
Biotin |
| Alternative Synonym: |
L3MBTL, ZC2HC3, H-L(3)MBT, dJ138B7.3 |
| L3MBTL Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
86kDa |
| NCBI: |
056293 |
| UniProt: |
Q9Y468 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: LLKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEGQPTASTPESEEWS |
