ZNF75 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2132909
Artikelname: ZNF75 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2132909
Hersteller Artikelnummer: orb2132909
Alternativnummer: BYT-ORB2132909-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF75
Konjugation: Biotin
Alternative Synonym: D8C6, ZNF75, ZNF82, ZSCAN28, ZKSCAN24
ZNF75 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 009062
UniProt: P51815
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LALSEQKRIKHWKMASKLILPESLSLLTFEDVAVYFSEEEWQLLNPLEKT