EED Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2133113
Artikelname: EED Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2133113
Hersteller Artikelnummer: orb2133113
Alternativnummer: BYT-ORB2133113-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EED
Konjugation: Biotin
Alternative Synonym: HEED, COGIS, WAIT1
EED Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 003788
UniProt: O75530
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC