SMARCD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2133182
Artikelname: SMARCD3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2133182
Hersteller Artikelnummer: orb2133182
Alternativnummer: BYT-ORB2133182-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCD3
Konjugation: Biotin
Alternative Synonym: Rsc6p, BAF60C, CRACD3
SMARCD3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 001003801
UniProt: Q6STE5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIASWELRVEG