SCN5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2133302
| Artikelname: |
SCN5A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2133302 |
| Hersteller Artikelnummer: |
orb2133302 |
| Alternativnummer: |
BYT-ORB2133302-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human SCN5A |
| Konjugation: |
Biotin |
| Alternative Synonym: |
HB1, HB2, HH1, IVF, VF1, HBBD, ICCD, LQT3, SSS1, CDCD2, CMD1E, CMPD2, PFHB1, Nav1.5 |
| SCN5A Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
222kDa |
| NCBI: |
000326 |
| UniProt: |
Q8IZC9 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM |
