KCNG4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2133419
Artikelname: KCNG4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2133419
Hersteller Artikelnummer: orb2133419
Alternativnummer: BYT-ORB2133419-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KCNG4
Konjugation: Biotin
Alternative Synonym: KV6.3, KV6.4
KCNG4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 758857
UniProt: Q8TDN1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP