TRPV4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2133500
Artikelname: TRPV4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2133500
Hersteller Artikelnummer: orb2133500
Alternativnummer: BYT-ORB2133500-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRPV4
Konjugation: Biotin
Alternative Synonym: SMAL, VRL2, BCYM3, CMT2C, SPSMA, TRP12, VROAC, HMSN2C, OTRPC4, SSQTL1
TRPV4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 91kDa
NCBI: 671737
UniProt: Q9HBA0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR