CHRFAM7A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2133512
Artikelname: CHRFAM7A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2133512
Hersteller Artikelnummer: orb2133512
Alternativnummer: BYT-ORB2133512-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CHRFAM7A
Konjugation: Biotin
Alternative Synonym: D-10, CHRNA7, NACHRA7, CHRNA7-DR1
CHRFAM7A Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 647536
UniProt: Q494W8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSC