TOMM40L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2133554
Artikelname: TOMM40L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2133554
Hersteller Artikelnummer: orb2133554
Alternativnummer: BYT-ORB2133554-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TOMM40L
Konjugation: Biotin
Alternative Synonym: TOMM40B
TOMM40L Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 115550
UniProt: Q969M1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGL