KCNK12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2133596
Artikelname: KCNK12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2133596
Hersteller Artikelnummer: orb2133596
Alternativnummer: BYT-ORB2133596-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KCNK12
Konjugation: Biotin
Alternative Synonym: THIK2, THIK-2, K2p12.1
KCNK12 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 071338
UniProt: Q9HB15
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF