KCNJ12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2133650
| Artikelname: |
KCNJ12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2133650 |
| Hersteller Artikelnummer: |
orb2133650 |
| Alternativnummer: |
BYT-ORB2133650-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human KCNJ12 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
IRK2, hIRK, IRK-2, hIRK1, KCNJN1, Kir2.2, Kir2.2v, kcnj12x, hkir2.2x |
| KCNJ12 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
49kDa |
| NCBI: |
066292 |
| UniProt: |
Q14500 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR |
