ACCN2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2133671
Artikelname: ACCN2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2133671
Hersteller Artikelnummer: orb2133671
Alternativnummer: BYT-ORB2133671-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACCN2
Konjugation: Biotin
Alternative Synonym: ASIC, ACCN2, BNaC2
ACCN2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 65kDa
NCBI: 064423
UniProt: P78348
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF