MCOLN3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2133692
Artikelname: MCOLN3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2133692
Hersteller Artikelnummer: orb2133692
Alternativnummer: BYT-ORB2133692-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MCOLN3
Konjugation: Biotin
Alternative Synonym: TRPML3, TRP-ML3
MCOLN3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 64kDa
NCBI: 060768
UniProt: Q8TDD5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDI