CHRNA9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2133701
| Artikelname: |
CHRNA9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2133701 |
| Hersteller Artikelnummer: |
orb2133701 |
| Alternativnummer: |
BYT-ORB2133701-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen for Anti-CHRNA9 antibody is: synthetic peptide directed towards the N-terminal region of Human ACHA9 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
NACHRA9, HSA243342 |
| CHRNA9 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
52 kDa |
| NCBI: |
060051 |
| UniProt: |
Q9UGM1 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: NWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVED |
