KCNK4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2133713
Artikelname: KCNK4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2133713
Hersteller Artikelnummer: orb2133713
Alternativnummer: BYT-ORB2133713-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KCNK4
Konjugation: Biotin
Alternative Synonym: FHEIG, TRAAK, K2p4.1, TRAAK1
KCNK4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 46kDa
UniProt: Q9NYG8
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGLLIKEVA