SCN8A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2133773
| Artikelname: |
SCN8A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2133773 |
| Hersteller Artikelnummer: |
orb2133773 |
| Alternativnummer: |
BYT-ORB2133773-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SCN8A |
| Konjugation: |
Biotin |
| Alternative Synonym: |
MED, PN4, CIAT, BFIS5, DEE13, NaCh6, CERIII, EIEE13, MYOCL2, Nav1.6 |
| SCN8A Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
225kDa |
| NCBI: |
055006 |
| UniProt: |
Q9UQD0 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC |
