ZNF547 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2134157
Artikelname: ZNF547 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2134157
Hersteller Artikelnummer: orb2134157
Alternativnummer: BYT-ORB2134157-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF547
Konjugation: Biotin
Alternative Synonym: MIP-2A, SEDLP1, TRAPPC2B, TRAPPC2P1, TRAPPC2.19
ZNF547 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 72498
UniProt: Q8IVP9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GTHPEQGLYTCPAHLHQHQKEQIREKLSRGDGGRPTFVKNHRVHMAGKTF