LRRC14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2134499
Artikelname: LRRC14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2134499
Hersteller Artikelnummer: orb2134499
Alternativnummer: BYT-ORB2134499-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LRRC14
Konjugation: Biotin
Alternative Synonym: LRRC14A
LRRC14 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 055480
UniProt: Q15048
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: ELLRDSVAQAELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVE