TAF6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2134538
Artikelname: TAF6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2134538
Hersteller Artikelnummer: orb2134538
Alternativnummer: BYT-ORB2134538-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAF6
Konjugation: Biotin
Alternative Synonym: ALYUS, TAF2E, TAFII70, TAFII80, TAFII85, MGC:8964, TAFII-70, TAFII-80, TAF(II)70, TAF(II)80
TAF6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 71kDa
NCBI: 620834
UniProt: A4D2B3
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: LTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHA