CREB3L2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2134565
Artikelname: CREB3L2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2134565
Hersteller Artikelnummer: orb2134565
Alternativnummer: BYT-ORB2134565-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CREB3L2
Konjugation: Biotin
Alternative Synonym: BBF2H7
CREB3L2 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 57 kDa
NCBI: 919047
UniProt: Q70SY1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GGWDRGSSLLRVSGLESRPDVDLPHFIISNETSLEKSVLLELQQHLVSAK