SMARCAD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2134730
Artikelname: SMARCAD1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2134730
Hersteller Artikelnummer: orb2134730
Alternativnummer: BYT-ORB2134730-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCAD1
Konjugation: Biotin
Alternative Synonym: HRZ, ETL1, HEL1, ADERM, BASNS
SMARCAD1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 117kDa
NCBI: 064544
UniProt: Q9H4L7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EEDEFNDDQSIKKTRLDHGEESNESAESSSNWEKQESIVLKLQKEFPNFD