PER3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2134796
Artikelname: PER3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2134796
Hersteller Artikelnummer: orb2134796
Alternativnummer: BYT-ORB2134796-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PER3
Konjugation: Biotin
Alternative Synonym: GIG13, FASPS3
PER3 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 132kDa
NCBI: 058515
UniProt: Q8TAR6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAAL