LIMA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2134817
Artikelname: LIMA1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2134817
Hersteller Artikelnummer: orb2134817
Alternativnummer: BYT-ORB2134817-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LIMA1
Konjugation: Biotin
Alternative Synonym: EPLIN, LDLCQ8, SREBP3
LIMA1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 85kDa
NCBI: 057441
UniProt: Q9UHB6
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: GVLAASMEAKASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGIKM