TAF9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2134820
| Artikelname: |
TAF9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2134820 |
| Hersteller Artikelnummer: |
orb2134820 |
| Alternativnummer: |
BYT-ORB2134820-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ChIP, IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human TAF9 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
TAF2G, TAFII31, TAFII32, MGC:5067, TAFII-31, TAFII-32, TAFIID32, STAF31/32 |
| TAF9 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
19kDa |
| NCBI: |
001015891 |
| UniProt: |
Q9Y3D8 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD |
