RTRAF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2134832
| Artikelname: |
RTRAF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2134832 |
| Hersteller Artikelnummer: |
orb2134832 |
| Alternativnummer: |
BYT-ORB2134832-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf166 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
CLE, CLE7, hCLE, CGI99, RLLM1, hCLE1, CGI-99, LCRP369, C14orf166 |
| RTRAF Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
28kDa |
| NCBI: |
057123 |
| UniProt: |
Q9Y224 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: GLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGV |
