Ergic2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2134859
| Artikelname: |
Ergic2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2134859 |
| Hersteller Artikelnummer: |
orb2134859 |
| Alternativnummer: |
BYT-ORB2134859-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ergic2 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Ptx1, AA408438, 1200009B18Rik, 4930572C01Rik |
| Ergic2 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
34kDa |
| NCBI: |
080631 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MRRLNRRKTLSLVKELDAFPKVPDSYVETSASGGTVSLIAFTTMALLTIM |
